Lineage for d1jjra_ (1jjr A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340192Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2340206Superfamily a.140.2: SAP domain [68906] (1 family) (S)
  5. 2340207Family a.140.2.1: SAP domain [68907] (8 protein domains)
    Pfam PF02037
  6. 2340208Protein DNA binding C-terminal domain of ku70 [68908] (1 species)
  7. 2340209Species Human (Homo sapiens) [TaxId:9606] [68909] (2 PDB entries)
  8. 2340211Domain d1jjra_: 1jjr A: [66772]

Details for d1jjra_

PDB Entry: 1jjr (more details)

PDB Description: The Three-Dimensional Structure of the C-terminal DNA Binding Domain of Human Ku70
PDB Compounds: (A:) thyroid autoantigen

SCOPe Domain Sequences for d1jjra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjra_ a.140.2.1 (A:) DNA binding C-terminal domain of ku70 {Human (Homo sapiens) [TaxId: 9606]}
kveyseeelkthiskgtlgkftvpmlkeacrayglksglkkqellealtkhfqd

SCOPe Domain Coordinates for d1jjra_:

Click to download the PDB-style file with coordinates for d1jjra_.
(The format of our PDB-style files is described here.)

Timeline for d1jjra_: