Lineage for d1jjo.2 (1jjo B:,D:,F:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 140365Fold e.1: Serpins [56573] (1 superfamily)
  4. 140366Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 140367Family e.1.1.1: Serpins [56575] (12 proteins)
  6. 140419Protein Neuroserpin [69871] (1 species)
  7. 140420Species Mouse (Mus musculus) [TaxId:10090] [69872] (1 PDB entry)
  8. 140422Domain d1jjo.2: 1jjo B:,D:,F: [66771]

Details for d1jjo.2

PDB Entry: 1jjo (more details), 3.06 Å

PDB Description: Crystal Structure of Mouse Neuroserpin (Cleaved form)
PDB Compounds: (B:) , (D:) , (F:)

SCOP Domain Sequences for d1jjo.2:

Sequence, based on SEQRES records: (download)

>g1jjo.2 e.1.1.1 (B:,D:,F:) Neuroserpin {Mouse (Mus musculus)}
titewsvnmynhlrgtgedenilfsplsialamgmmelgaXenqyvmklanslfvqngfh
vneeflqmlkmyfnaevnhvdfsqnvavansinkwvenytnsllkdlvspedfdgvtnla
linavyfkgnwksqfrpentrtfsftkddesevqipmmyqqgefyygefsdgsneaggiy
qvleipyegdeismmlalsrqevplatlepllkaqlieewansvkkqkvevylprftveq
eidlkdilkalgvteifikdanltamsdkkelflskavhkscievneegseaaaasgmia
isXypqvivdhpflylirnrksgiilfmgrvmnphh

Sequence, based on observed residues (ATOM records): (download)

>g1jjo.2 e.1.1.1 (B:,D:,F:) Neuroserpin {Mouse (Mus musculus)}
titewsvnmynhlrgtgedenilfsplsialamgmmelgaXenqyvmklanslfvqngfh
vneeflqmlkmyfnaevnhvdfsqnvavansinkwvenytnsllkdlvspedfdgvtnla
linavyfkgnwksqfrpentrtfsftkddesevqipmmyqqgefyygefsdgsneaggiy
qvleipyegdeismmlalsrqevplatlepllkaqlieewansvkkqkvevylprftveq
eidlkdilkalgvteflskavhkscievneegseaaaasgmiaisXypqvivdhpflyli
rnrksgiilfmgrvmnphh

SCOP Domain Coordinates for d1jjo.2:

Click to download the PDB-style file with coordinates for d1jjo.2.
(The format of our PDB-style files is described here.)

Timeline for d1jjo.2: