Lineage for d1jjo.1 (1jjo A:,C:,E:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568274Protein Neuroserpin [69871] (1 species)
  7. 2568275Species Mouse (Mus musculus) [TaxId:10090] [69872] (1 PDB entry)
  8. 2568276Domain d1jjo.1: 1jjo A:,C:,E: [66770]
    cleaved form

Details for d1jjo.1

PDB Entry: 1jjo (more details), 3.06 Å

PDB Description: Crystal Structure of Mouse Neuroserpin (Cleaved form)
PDB Compounds: (A:) neuroserpin, (C:) neuroserpin, (E:) neuroserpin

SCOPe Domain Sequences for d1jjo.1:

Sequence, based on SEQRES records: (download)

>g1jjo.1 e.1.1.1 (A:,C:,E:) Neuroserpin {Mouse (Mus musculus) [TaxId: 10090]}
titewsvnmynhlrgtgedenilfsplsialamgmmelgaXenqyvmklanslfvqngfh
vneeflqmlkmyfnaevnhvdfsqnvavansinkwvenytnsllkdlvspedfdgvtnla
linavyfkgnwksqfrpentrtfsftkddesevqipmmyqqgefyygefsdgsneaggiy
qvleipyegdeismmlalsrqevplatlepllkaqlieewansvkkqkvevylprftveq
eidlkdilkalgvteifikdanltamsdkkelflskavhkscievneegseaaaasgmia
isXypqvivdhpflylirnrksgiilfmgrvmnphh

Sequence, based on observed residues (ATOM records): (download)

>g1jjo.1 e.1.1.1 (A:,C:,E:) Neuroserpin {Mouse (Mus musculus) [TaxId: 10090]}
titewsvnmynhlrgtgedenilfsplsialamgmmelgaXenqyvmklanslfvqngfh
vneeflqmlkmyfnaevnhvdfsqnvavansinkwvenytnsllkdlvspedfdgvtnla
linavyfkgnwksqfrpentrtfsftkddesevqipmmyqqgefyygefsdgsneaggiy
qvleipyegdeismmlalsrqevplatlepllkaqlieewansvkkqkvevylprftveq
eidlkdilkalgvteflskavhkscievneegseaaaasgmiaisXypqvivdhpflyli
rnrksgiilfmgrvmnphh

SCOPe Domain Coordinates for d1jjo.1:

Click to download the PDB-style file with coordinates for d1jjo.1.
(The format of our PDB-style files is described here.)

Timeline for d1jjo.1: