![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.2: Carboxylesterase [53487] (7 proteins) |
![]() | Protein Carboxylesterase [53488] (3 species) bacterial homologue of human hormone sensitive lipase |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [69576] (1 PDB entry) |
![]() | Domain d1jjid_: 1jji D: [66769] complexed with epe |
PDB Entry: 1jji (more details), 2.2 Å
SCOPe Domain Sequences for d1jjid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjid_ c.69.1.2 (D:) Carboxylesterase {Archaeoglobus fulgidus [TaxId: 2234]} mldmpidpvyyqlaeyfdslpkfdqfssareyreainriyeernrqlsqhervervedrt ikgrngdirvrvyqqkpdspvlvyyhgggfvicsieshdalcrriarlsnstvvsvdyrl apehkfpaavydcydatkwvaenaeelridpskifvggdsaggnlaaavsimardsgedf ikhqiliypvvnfvaptpsllefgeglwildqkimswfseqyfsreedkfnplasvifad lenlppaliitaeydplrdegevfgqmlrragveasivryrgvlhgfinyypvlkaarda inqiaallvfd
Timeline for d1jjid_: