Lineage for d1jjib_ (1jji B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2507635Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 2507636Protein Carboxylesterase [53488] (3 species)
    bacterial homologue of human hormone sensitive lipase
  7. 2507642Species Archaeoglobus fulgidus [TaxId:2234] [69576] (1 PDB entry)
  8. 2507644Domain d1jjib_: 1jji B: [66767]
    complexed with epe

Details for d1jjib_

PDB Entry: 1jji (more details), 2.2 Å

PDB Description: The Crystal Structure of a Hyper-thermophilic Carboxylesterase from the Archaeon Archaeoglobus fulgidus
PDB Compounds: (B:) carboxylesterase

SCOPe Domain Sequences for d1jjib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjib_ c.69.1.2 (B:) Carboxylesterase {Archaeoglobus fulgidus [TaxId: 2234]}
mldmpidpvyyqlaeyfdslpkfdqfssareyreainriyeernrqlsqhervervedrt
ikgrngdirvrvyqqkpdspvlvyyhgggfvicsieshdalcrriarlsnstvvsvdyrl
apehkfpaavydcydatkwvaenaeelridpskifvggdsaggnlaaavsimardsgedf
ikhqiliypvvnfvaptpsllefgeglwildqkimswfseqyfsreedkfnplasvifad
lenlppaliitaeydplrdegevfgqmlrragveasivryrgvlhgfinyypvlkaarda
inqiaallvfd

SCOPe Domain Coordinates for d1jjib_:

Click to download the PDB-style file with coordinates for d1jjib_.
(The format of our PDB-style files is described here.)

Timeline for d1jjib_: