Lineage for d1jjcb6 (1jjc B:191-399)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137800Fold d.138: B3/B4 domain of PheRS, PheT [56036] (1 superfamily)
  4. 137801Superfamily d.138.1: B3/B4 domain of PheRS, PheT [56037] (1 family) (S)
  5. 137802Family d.138.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)
  6. 137803Protein B3/B4 domain of PheRS, PheT [56039] (1 species)
  7. 137804Species Thermus thermophilus (Thermus aquaticus) [56040] (5 PDB entries)
  8. 137805Domain d1jjcb6: 1jjc B:191-399 [66764]
    Other proteins in same PDB: d1jjca_, d1jjcb1, d1jjcb2, d1jjcb3, d1jjcb4, d1jjcb5

Details for d1jjcb6

PDB Entry: 1jjc (more details), 2.6 Å

PDB Description: Crystal structure at 2.6A resolution of phenylalanyl-tRNA synthetase complexed with phenylalanyl-adenylate in the presence of manganese

SCOP Domain Sequences for d1jjcb6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjcb6 d.138.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus (Thermus aquaticus)}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

SCOP Domain Coordinates for d1jjcb6:

Click to download the PDB-style file with coordinates for d1jjcb6.
(The format of our PDB-style files is described here.)

Timeline for d1jjcb6: