![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.138: B3/B4 domain of PheRS, PheT [56036] (1 superfamily) |
![]() | Superfamily d.138.1: B3/B4 domain of PheRS, PheT [56037] (1 family) ![]() |
![]() | Family d.138.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein) |
![]() | Protein B3/B4 domain of PheRS, PheT [56039] (1 species) |
![]() | Species Thermus thermophilus (Thermus aquaticus) [56040] (5 PDB entries) |
![]() | Domain d1jjcb6: 1jjc B:191-399 [66764] Other proteins in same PDB: d1jjca_, d1jjcb1, d1jjcb2, d1jjcb3, d1jjcb4, d1jjcb5 |
PDB Entry: 1jjc (more details), 2.6 Å
SCOP Domain Sequences for d1jjcb6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjcb6 d.138.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus (Thermus aquaticus)} lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv paqrralsllqalagarvaealleagspk
Timeline for d1jjcb6: