SCOPe 2.06: Domain d1jjcb5: 1jjc B:475-681

Lineage for d1jjcb5 (1jjc B:475-681)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
   this domain is non-catalytic

7. Species Thermus thermophilus [TaxId:274] [55704] (12 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d1jjcb5: 1jjc B:475-681 [66763]
   Other proteins in same PDB: d1jjca_, d1jjcb1, d1jjcb2, d1jjcb3, d1jjcb4, d1jjcb6
   protein/RNA complex; complexed with fa5, mn, so4

Details for d1jjcb5

PDB Entry: 1jjc, 2.6 Å

PDB Description: Crystal structure at 2.6A resolution of phenylalanyl-tRNA synthetase complexed with phenylalanyl-adenylate in the presence of manganese

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d1jjcb5:

Sequence; same for both SEQRES and ATOM records:

>d1jjcb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

Timeline for d1jjcb5:

• d1jjcb5 first appeared in SCOP 1.59
  
• d1jjcb5 appears in SCOPe 2.05
  
• d1jjcb5 appears in SCOPe 2.07
  
• d1jjcb5 appears in the current release, SCOPe 2.08