Lineage for d1jjcb1 (1jjc B:1-38,B:152-190)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309714Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2309715Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2309716Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
    duplication: contains two such domains related by pseudo dyad
  6. 2309717Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 2309718Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2309719Domain d1jjcb1: 1jjc B:1-38,B:152-190 [66759]
    Other proteins in same PDB: d1jjca_, d1jjcb3, d1jjcb4, d1jjcb5, d1jjcb6
    protein/RNA complex; complexed with fa5, mn, so4

Details for d1jjcb1

PDB Entry: 1jjc (more details), 2.6 Å

PDB Description: Crystal structure at 2.6A resolution of phenylalanyl-tRNA synthetase complexed with phenylalanyl-adenylate in the presence of manganese
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d1jjcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjcb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

SCOPe Domain Coordinates for d1jjcb1:

Click to download the PDB-style file with coordinates for d1jjcb1.
(The format of our PDB-style files is described here.)

Timeline for d1jjcb1: