SCOPe 2.07: Domain d1jjcb1: 1jjc B:1-38,B:152-190

Lineage for d1jjcb1 (1jjc B:1-38,B:152-190)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
   duplication: contains two such domains related by pseudo dyad

6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d1jjcb1: 1jjc B:1-38,B:152-190 [66759]
   Other proteins in same PDB: d1jjca_, d1jjcb3, d1jjcb4, d1jjcb5, d1jjcb6
   protein/RNA complex; complexed with fa5, mn, so4

Details for d1jjcb1

PDB Entry: 1jjc, 2.6 Å

PDB Description: Crystal structure at 2.6A resolution of phenylalanyl-tRNA synthetase complexed with phenylalanyl-adenylate in the presence of manganese

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d1jjcb1:

Sequence; same for both SEQRES and ATOM records:

>d1jjcb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

Timeline for d1jjcb1:

• d1jjcb1 first appeared in SCOP 1.59
  
• d1jjcb1 appears in SCOPe 2.06
  
• d1jjcb1 appears in the current release, SCOPe 2.08