Lineage for d1jjcb1 (1jjc B:1-38,B:152-190)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 150662Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
  4. 150663Superfamily a.6.1: Putative DNA-binding domain [46955] (5 families) (S)
  5. 150664Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
  6. 150665Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 150666Species Thermus thermophilus (Thermus aquaticus) [46958] (5 PDB entries)
  8. 150667Domain d1jjcb1: 1jjc B:1-38,B:152-190 [66759]
    Other proteins in same PDB: d1jjca_, d1jjcb3, d1jjcb4, d1jjcb5, d1jjcb6

Details for d1jjcb1

PDB Entry: 1jjc (more details), 2.6 Å

PDB Description: Crystal structure at 2.6A resolution of phenylalanyl-tRNA synthetase complexed with phenylalanyl-adenylate in the presence of manganese

SCOP Domain Sequences for d1jjcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjcb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

SCOP Domain Coordinates for d1jjcb1:

Click to download the PDB-style file with coordinates for d1jjcb1.
(The format of our PDB-style files is described here.)

Timeline for d1jjcb1: