| Class a: All alpha proteins [46456] (151 folds) |
| Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) |
Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families) ![]() |
| Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein) |
| Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species) |
| Species Thermus thermophilus (Thermus aquaticus) [46958] (5 PDB entries) |
| Domain d1jjcb1: 1jjc B:1-38,B:152-190 [66759] Other proteins in same PDB: d1jjca_, d1jjcb3, d1jjcb4, d1jjcb5, d1jjcb6 |
PDB Entry: 1jjc (more details), 2.6 Å
SCOP Domain Sequences for d1jjcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjcb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa
Timeline for d1jjcb1: