![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
![]() | Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [55702] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
![]() | Domain d1jjca_: 1jjc A: [66758] Other proteins in same PDB: d1jjcb1, d1jjcb2, d1jjcb3, d1jjcb4, d1jjcb5, d1jjcb6 protein/RNA complex; complexed with fa5, mn, so4 |
PDB Entry: 1jjc (more details), 2.6 Å
SCOPe Domain Sequences for d1jjca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjca_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam lrygipdiryffggrlkfleqfkgvl
Timeline for d1jjca_: