Lineage for d1jjca_ (1jjc A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195363Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 195364Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 195365Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)
  6. 195447Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 195448Species Thermus thermophilus and (Thermus aquaticus) [55702] (5 PDB entries)
  8. 195449Domain d1jjca_: 1jjc A: [66758]
    Other proteins in same PDB: d1jjcb1, d1jjcb2, d1jjcb3, d1jjcb4, d1jjcb5, d1jjcb6

Details for d1jjca_

PDB Entry: 1jjc (more details), 2.6 Å

PDB Description: Crystal structure at 2.6A resolution of phenylalanyl-tRNA synthetase complexed with phenylalanyl-adenylate in the presence of manganese

SCOP Domain Sequences for d1jjca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjca_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus and (Thermus aquaticus)}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOP Domain Coordinates for d1jjca_:

Click to download the PDB-style file with coordinates for d1jjca_.
(The format of our PDB-style files is described here.)

Timeline for d1jjca_: