Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins) |
Protein HIN recombinase (DNA-binding domain) [46729] (1 species) |
Species Synthetic [46730] (8 PDB entries) |
Domain d1jj8c_: 1jj8 C: [66757] protein/DNA complex; mutant |
PDB Entry: 1jj8 (more details), 2.75 Å
SCOPe Domain Sequences for d1jj8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jj8c_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} grprainkheqeqisrllekghprqqlaiifgigvstlyryfpassikk
Timeline for d1jj8c_: