Lineage for d1jj8c_ (1jj8 C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720629Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 1720644Protein HIN recombinase (DNA-binding domain) [46729] (1 species)
  7. 1720645Species Synthetic [46730] (8 PDB entries)
  8. 1720650Domain d1jj8c_: 1jj8 C: [66757]
    protein/DNA complex; mutant

Details for d1jj8c_

PDB Entry: 1jj8 (more details), 2.75 Å

PDB Description: Testing the Water-Mediated HIN Recombinase DNA Recognition by Systematic Mutations
PDB Compounds: (C:) DNA-invertase hin

SCOPe Domain Sequences for d1jj8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj8c_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic}
grprainkheqeqisrllekghprqqlaiifgigvstlyryfpassikk

SCOPe Domain Coordinates for d1jj8c_:

Click to download the PDB-style file with coordinates for d1jj8c_.
(The format of our PDB-style files is described here.)

Timeline for d1jj8c_: