Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins) |
Protein HIN recombinase (DNA-binding domain) [46729] (1 species) |
Species Synthetic [46730] (8 PDB entries) |
Domain d1jj6c_: 1jj6 C: [66756] protein/DNA complex; complexed with trs; mutant |
PDB Entry: 1jj6 (more details), 2.3 Å
SCOPe Domain Sequences for d1jj6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jj6c_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} grprainkheqeqisrllekghprqqlaiifgigvstlyryfpassi
Timeline for d1jj6c_: