Lineage for d1jipa_ (1jip A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005312Protein Cytochrome P450-ERYF [48272] (1 species)
  7. 2005313Species Saccharopolyspora erythraea [TaxId:1836] [48273] (10 PDB entries)
  8. 2005317Domain d1jipa_: 1jip A: [66748]
    complexed with hem, ktn

Details for d1jipa_

PDB Entry: 1jip (more details), 2 Å

PDB Description: P450eryF(A245S)/ketoconazole
PDB Compounds: (A:) cytochrome p450 107a1

SCOPe Domain Sequences for d1jipa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jipa_ a.104.1.1 (A:) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]}
ttvpdlesdsfhvdwyrtyaelretapvtpvrflgqdawlvtgydeakaalsdlrlssdp
kkkypgvevefpaylgfpedvrnyfatnmgtsdppthtrlrklvsqeftvrrveamrprv
eqitaelldevgdsgvvdivdrfahplpikvicellgvdekyrgefgrwsseilvmdper
aeqrgqaarevvnfildlverrrtepgddllsalirvqddddgrlsadeltsialvllla
gfessvsligigtylllthpdqlalvrrdpsalpnaveeilryiappetttrfaaeevei
ggvaipqystvlvangaanrdpkqfpdphrfdvtrdtrghlsfgqgihfcmgrplakleg
evalralfgrfpalslgidaddvvwrrslllrgidhlpvrldg

SCOPe Domain Coordinates for d1jipa_:

Click to download the PDB-style file with coordinates for d1jipa_.
(The format of our PDB-style files is described here.)

Timeline for d1jipa_: