Lineage for d1jioa_ (1jio A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100199Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 100200Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 100201Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 100283Protein Cytochrome P450-ERYF [48272] (1 species)
  7. 100284Species Saccaropolyspora erythraea [48273] (6 PDB entries)
  8. 100286Domain d1jioa_: 1jio A: [66747]

Details for d1jioa_

PDB Entry: 1jio (more details), 2.1 Å

PDB Description: P450eryF/6DEB

SCOP Domain Sequences for d1jioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jioa_ a.104.1.1 (A:) Cytochrome P450-ERYF {Saccaropolyspora erythraea}
ttvpdlesdsfhvdwyrtyaelretapvtpvrflgqdawlvtgydeakaalsdlrlssdp
kkkypgvevefpaylgfpedvrnyfatnmgtsdppthtrlrklvsqeftvrrveamrprv
eqitaelldevgdsgvvdivdrfahplpikvicellgvdekyrgefgrwsseilvmdper
aeqrgqaarevvnfildlverrrtepgddllsalirvqddddgrlsadeltsialvllla
gfeasvsligigtylllthpdqlalvrrdpsalpnaveeilryiappetttrfaaeevei
ggvaipqystvlvangaanrdpkqfpdphrfdvtrdtrghlsfgqgihfcmgrplakleg
evalralfgrfpalslgidaddvvwrrslllrgidhlpvrldg

SCOP Domain Coordinates for d1jioa_:

Click to download the PDB-style file with coordinates for d1jioa_.
(The format of our PDB-style files is described here.)

Timeline for d1jioa_: