SCOPe 2.06: Domain d1jila_: 1jil A:

Lineage for d1jila_ (1jil A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species)

7. Species Staphylococcus aureus [TaxId:1280] [69453] (4 PDB entries)

8. Domain d1jila_: 1jil A: [66745]
   complexed with 485

Details for d1jila_

PDB Entry: 1jil, 2.2 Å

PDB Description: Crystal structure of S. aureus TyrRS in complex with SB284485

PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1jila_:

Sequence; same for both SEQRES and ATOM records:

>d1jila_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus aureus [TaxId: 1280]}
tnvliedlkwrgliyqqtdeqgiedllnkeqvtlycgadptadslhighllpfltlrrfq
ehghrpivligggtgmigdpsgkseervlqteeqvdkniegiskqmhnifefgtdhgavl
vnnrdwlgqislisflrdygkhvgvnymlgkdsiqsrlehgisyteftytilqaidfghl
nrelnckiqvggsdqwgnitsgielmrrmygqtdaygltiplvtksdgkkfgksesgavw
ldaektspyefyqfwinqsdedvikflkyftflgkeeidrleqskneaphlreaqktlae
evtkfihgedalndairisqalf

Timeline for d1jila_:

• d1jila_ first appeared in SCOP 1.59
  
• d1jila_ appears in SCOPe 2.05
  
• d1jila_ appears in SCOPe 2.07
  
• d1jila_ appears in the current release, SCOPe 2.08