Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species) |
Species Staphylococcus aureus [TaxId:1280] [69453] (4 PDB entries) |
Domain d1jija_: 1jij A: [66743] complexed with 629 |
PDB Entry: 1jij (more details), 3.2 Å
SCOPe Domain Sequences for d1jija_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jija_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus aureus [TaxId: 1280]} tnvliedlkwrgliyqqtdeqgiedllnkeqvtlycgadptadslhighllpfltlrrfq ehghrpivligggtgmigdpsgkseervlqteeqvdkniegiskqmhnifefgtdhgavl vnnrdwlgqislisflrdygkhvgvnymlgkdsiqsrlehgisyteftytilqaidfghl nrelnckiqvggsdqwgnitsgielmrrmygqtdaygltiplvtksdgkkfgksesgavw ldaektspyefyqfwinqsdedvikflkyftflgkeeidrleqskneaphlreaqktlae evtkfihgedalndairis
Timeline for d1jija_: