Lineage for d1jija_ (1jij A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841353Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1841535Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species)
  7. 1841565Species Staphylococcus aureus [TaxId:1280] [69453] (4 PDB entries)
  8. 1841568Domain d1jija_: 1jij A: [66743]
    complexed with 629

Details for d1jija_

PDB Entry: 1jij (more details), 3.2 Å

PDB Description: crystal structure of s. aureus tyrrs in complex with sb-239629
PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1jija_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jija_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus aureus [TaxId: 1280]}
tnvliedlkwrgliyqqtdeqgiedllnkeqvtlycgadptadslhighllpfltlrrfq
ehghrpivligggtgmigdpsgkseervlqteeqvdkniegiskqmhnifefgtdhgavl
vnnrdwlgqislisflrdygkhvgvnymlgkdsiqsrlehgisyteftytilqaidfghl
nrelnckiqvggsdqwgnitsgielmrrmygqtdaygltiplvtksdgkkfgksesgavw
ldaektspyefyqfwinqsdedvikflkyftflgkeeidrleqskneaphlreaqktlae
evtkfihgedalndairis

SCOPe Domain Coordinates for d1jija_:

Click to download the PDB-style file with coordinates for d1jija_.
(The format of our PDB-style files is described here.)

Timeline for d1jija_: