SCOP 1.69: Domain d1jifb_: 1jif B:

Lineage for d1jifb_ (1jif B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (4 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Bleomycin resistance protein, BRP [54599] (3 species)
   Active as dimer

7. Species Streptomyces verticillus [TaxId:29309] [54600] (3 PDB entries)

8. Domain d1jifb_: 1jif B: [66739]

Details for d1jifb_

PDB Entry: 1jif, 1.6 Å

PDB Description: Crystal structure of bleomycin-binding protein from bleomycin-producing Streptomyces verticillus complexed with copper(II)-bleomycin

SCOP Domain Sequences for d1jifb_:

Sequence; same for both SEQRES and ATOM records:

>d1jifb_ d.32.1.2 (B:) Bleomycin resistance protein, BRP {Streptomyces verticillus}
mvkflgavpvltavdvpanvsfwvdtlgfekdfgdrdfagvrrgdirlhisrtehqivad
ntsawievtdpdalheewaravstdyadtsgpamtpvgespagrefavrdpagncvhfta
ge

Timeline for d1jifb_:

• d1jifb_ first appeared in SCOP 1.59
  
• d1jifb_ appears in SCOP 1.67
  
• d1jifb_ appears in SCOP 1.71
  
• d1jifb_ appears in the current release, SCOPe 2.08