Lineage for d1jiea_ (1jie A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549490Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2549491Protein Bleomycin resistance protein, BRP [54599] (3 species)
    Active as dimer
  7. 2549511Species Streptomyces verticillus [TaxId:29309] [54600] (3 PDB entries)
  8. 2549515Domain d1jiea_: 1jie A: [66736]
    complexed with blm

Details for d1jiea_

PDB Entry: 1jie (more details), 1.8 Å

PDB Description: crystal structure of bleomycin-binding protein from bleomycin- producing streptomyces verticillus complexed with metal-free bleomycin
PDB Compounds: (A:) bleomycin-binding protein

SCOPe Domain Sequences for d1jiea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiea_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]}
mvkflgavpvltavdvpanvsfwvdtlgfekdfgdrdfagvrrgdirlhisrtehqivad
ntsawievtdpdalheewaravstdyadtsgpamtpvgespagrefavrdpagncvhfta
ge

SCOPe Domain Coordinates for d1jiea_:

Click to download the PDB-style file with coordinates for d1jiea_.
(The format of our PDB-style files is described here.)

Timeline for d1jiea_: