SCOPe 2.05: Domain d1jida_: 1jid A:

Lineage for d1jida_ (1jid A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.201: SRP19 [69694] (1 superfamily)
   beta-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.201.1: SRP19 [69695] (2 families)
   automatically mapped to Pfam PF01922

5. Family d.201.1.1: SRP19 [69696] (1 protein)

6. Protein SRP19 [69697] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69698] (4 PDB entries)

8. Domain d1jida_: 1jid A: [66735]
   protein/RNA complex; complexed with mg

Details for d1jida_

PDB Entry: 1jid, 1.8 Å

PDB Description: human srp19 in complex with helix 6 of human srp rna

PDB Compounds: (A:) signal recognition particle 19 kda protein

SCOPe Domain Sequences for d1jida_:

Sequence; same for both SEQRES and ATOM records:

>d1jida_ d.201.1.1 (A:) SRP19 {Human (Homo sapiens) [TaxId: 9606]}
aarspadqdrficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvflek
nkmysrewnrdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktr

Timeline for d1jida_:

• d1jida_ first appeared in SCOP 1.59
  
• d1jida_ appears in SCOPe 2.04
  
• d1jida_ appears in SCOPe 2.06
  
• d1jida_ appears in the current release, SCOPe 2.08