Lineage for d1jida_ (1jid A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515769Fold d.201: SRP19 [69694] (1 superfamily)
    beta-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 515770Superfamily d.201.1: SRP19 [69695] (1 family) (S)
  5. 515771Family d.201.1.1: SRP19 [69696] (1 protein)
  6. 515772Protein SRP19 [69697] (3 species)
  7. 515779Species Human (Homo sapiens) [TaxId:9606] [69698] (2 PDB entries)
  8. 515780Domain d1jida_: 1jid A: [66735]

Details for d1jida_

PDB Entry: 1jid (more details), 1.8 Å

PDB Description: human srp19 in complex with helix 6 of human srp rna

SCOP Domain Sequences for d1jida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jida_ d.201.1.1 (A:) SRP19 {Human (Homo sapiens)}
aarspadqdrficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvflek
nkmysrewnrdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktr

SCOP Domain Coordinates for d1jida_:

Click to download the PDB-style file with coordinates for d1jida_.
(The format of our PDB-style files is described here.)

Timeline for d1jida_: