SCOP 1.59: Domain d1jhja_: 1jhj A:

Lineage for d1jhja_ (1jhj A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (13 families)

5. Family b.18.1.9: APC10/DOC1 subunit of the anaphase-promoting complex [69210] (1 protein)

6. Protein APC10/DOC1 subunit of the anaphase-promoting complex [69211] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69212] (1 PDB entry)

8. Domain d1jhja_: 1jhj A: [66714]

Details for d1jhja_

PDB Entry: 1jhj, 1.6 Å

PDB Description: crystal structure of the apc10/doc1 subunit of the human anaphase- promoting complex

SCOP Domain Sequences for d1jhja_:

Sequence; same for both SEQRES and ATOM records:

>d1jhja_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Human (Homo sapiens)}
atpnktppgadpkqlertgtvreigsqavwslssckpgfgvdqlrddnletywqsdgsqp
hlvniqfrrkttvktlciyadyksdesytpskisvrvgnnfhnlqeirqlelvepsgwih
vpltdnhkkptrtfmiqiavlanhqngrdthmrqikiytpv

Timeline for d1jhja_:

• d1jhja_ is new in SCOP 1.59
  
• d1jhja_ appears in SCOP 1.61
  
• d1jhja_ appears in the current release, SCOPe 2.08