SCOPe 2.05: Domain d1jhda2: 1jhd A:174-396

Lineage for d1jhda2 (1jhd A:174-396)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
   automatically mapped to Pfam PF01747

6. Protein ATP sulfurylase catalytic domain [63980] (5 species)

7. Species Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId:35843] [69455] (1 PDB entry)
   lacks the C-terminal domain

8. Domain d1jhda2: 1jhd A:174-396 [66713]
   Other proteins in same PDB: d1jhda1
   complexed with br, so4

Details for d1jhda2

PDB Entry: 1jhd, 1.7 Å

PDB Description: Crystal Structure of Bacterial ATP Sulfurylase from the Riftia pachyptila Symbiont

PDB Compounds: (A:) sulfate adenylyltransferase

SCOPe Domain Sequences for d1jhda2:

Sequence; same for both SEQRES and ATOM records:

>d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]}
pdtfrtaveirneikehgwskvvafqtrnpmhraheelcrmamesldadgvvvhmllgkl
kkgdipapvrdaairtmaevyfppntvmvtgygfdmlyagpreavlhayfrqnmgathfi
igrdhagvgdyygafdaqtifddevpegameieifradhtayskklnkivmmrdvpdhtk
edfvllsgtkvremlgqgiapppefsrpevakilmdyyqsins

Timeline for d1jhda2:

• d1jhda2 first appeared in SCOP 1.59
  
• d1jhda2 appears in SCOPe 2.04
  
• d1jhda2 appears in SCOPe 2.06
  
• d1jhda2 appears in the current release, SCOPe 2.08