Lineage for d1jhda1 (1jhd A:1-173)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2823936Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
    automatically mapped to Pfam PF14306
  6. 2823937Protein ATP sulfurylase N-terminal domain [63802] (5 species)
  7. 2823967Species Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId:35843] [69296] (1 PDB entry)
  8. 2823968Domain d1jhda1: 1jhd A:1-173 [66712]
    Other proteins in same PDB: d1jhda2
    complexed with br, so4

Details for d1jhda1

PDB Entry: 1jhd (more details), 1.7 Å

PDB Description: Crystal Structure of Bacterial ATP Sulfurylase from the Riftia pachyptila Symbiont
PDB Compounds: (A:) sulfate adenylyltransferase

SCOPe Domain Sequences for d1jhda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhda1 b.122.1.3 (A:1-173) ATP sulfurylase N-terminal domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]}
mikpvgsdelkplfvydpeehhklsheaeslpsvvissqaagnavmmgagyfsplqgfmn
vadamgaaekmtlsdgsffpvpvlcllentdaigdakrialrdpnvegnpvlavmdieai
eevsdeqmavmtdkvyrttdmdhigvktfnsqgrvavsgpiqvlnfsyfqadf

SCOPe Domain Coordinates for d1jhda1:

Click to download the PDB-style file with coordinates for d1jhda1.
(The format of our PDB-style files is described here.)

Timeline for d1jhda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jhda2