Lineage for d1jh9a1 (1jh9 A:2-58)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322778Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 2322825Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)
  7. 2322826Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)
  8. 2322836Domain d1jh9a1: 1jh9 A:2-58 [66710]
    Other proteins in same PDB: d1jh9a2
    protein/DNA complex; complexed with hpa, po4; mutant

Details for d1jh9a1

PDB Entry: 1jh9 (more details), 2.55 Å

PDB Description: purine repressor mutant-hypoxanthine-purf operator complex
PDB Compounds: (A:) purine nucleotide synthesis repressor

SCOPe Domain Sequences for d1jh9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jh9a1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]}
atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh

SCOPe Domain Coordinates for d1jh9a1:

Click to download the PDB-style file with coordinates for d1jh9a1.
(The format of our PDB-style files is described here.)

Timeline for d1jh9a1: