SCOP 1.65: Domain d1jh9a1: 1jh9 A:2-58

Lineage for d1jh9a1 (1jh9 A:2-58)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (3 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)

7. Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)

8. Domain d1jh9a1: 1jh9 A:2-58 [66710]
   Other proteins in same PDB: d1jh9a2
   complexed with hpa, po4; mutant

Details for d1jh9a1

PDB Entry: 1jh9, 2.55 Å

PDB Description: purine repressor mutant-hypoxanthine-purf operator complex

SCOP Domain Sequences for d1jh9a1:

Sequence; same for both SEQRES and ATOM records:

>d1jh9a1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli}
atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh

Timeline for d1jh9a1:

• d1jh9a1 first appeared in SCOP 1.59
  
• d1jh9a1 appears in SCOP 1.63
  
• d1jh9a1 appears in SCOP 1.67
  
• d1jh9a1 appears in the current release, SCOPe 2.08