SCOPe 2.08: Domain d1jh7a1: 1jh7 A:1-181

Lineage for d1jh7a1 (1jh7 A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.61: LigT-like [55143] (1 superfamily)
   duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III

4. Superfamily d.61.1: LigT-like [55144] (5 families)

5. Family d.61.1.1: tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase [55145] (1 protein)
   automatically mapped to Pfam PF07823

6. Protein tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase [55146] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55147] (3 PDB entries)

8. Domain d1jh7a1: 1jh7 A:1-181 [66709]
   Other proteins in same PDB: d1jh7a2
   complexed with so4, uvc

Details for d1jh7a1

PDB Entry: 1jh7, 2.4 Å

PDB Description: Semi-reduced Inhibitor-bound Cyclic Nucleotide Phosphodiesterase from Arabidopsis thaliana

PDB Compounds: (A:) cyclic phosphodiesterase

SCOPe Domain Sequences for d1jh7a1:

Sequence; same for both SEQRES and ATOM records:

>d1jh7a1 d.61.1.1 (A:1-181) tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
meevkkdvysvwalpdeeseprfkklmealrseftgprfvphvtvavsayltadeakkmf
esacdglkaytatvdrvstgtfffqcvflllqttpevmeagehcknhfncstttpymphl
sllyaelteeekknaqekaytldssldglsfrlnrlalcktdtedktletwetvavcnln
p

Timeline for d1jh7a1:

• d1jh7a1 first appeared in SCOP 1.59, called d1jh7a_
  
• d1jh7a1 appears in SCOPe 2.07