Lineage for d1jh7a1 (1jh7 A:1-181)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2523189Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2523190Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2523191Family d.61.1.1: tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase [55145] (1 protein)
    automatically mapped to Pfam PF07823
  6. 2523192Protein tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase [55146] (1 species)
  7. 2523193Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55147] (3 PDB entries)
  8. 2523199Domain d1jh7a1: 1jh7 A:1-181 [66709]
    Other proteins in same PDB: d1jh7a2
    complexed with so4, uvc

Details for d1jh7a1

PDB Entry: 1jh7 (more details), 2.4 Å

PDB Description: Semi-reduced Inhibitor-bound Cyclic Nucleotide Phosphodiesterase from Arabidopsis thaliana
PDB Compounds: (A:) cyclic phosphodiesterase

SCOPe Domain Sequences for d1jh7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jh7a1 d.61.1.1 (A:1-181) tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
meevkkdvysvwalpdeeseprfkklmealrseftgprfvphvtvavsayltadeakkmf
esacdglkaytatvdrvstgtfffqcvflllqttpevmeagehcknhfncstttpymphl
sllyaelteeekknaqekaytldssldglsfrlnrlalcktdtedktletwetvavcnln
p

SCOPe Domain Coordinates for d1jh7a1:

Click to download the PDB-style file with coordinates for d1jh7a1.
(The format of our PDB-style files is described here.)

Timeline for d1jh7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jh7a2