SCOP 1.61: Domain d1jgvl1: 1jgv L:1-107

Lineage for d1jgvl1 (1jgv L:1-107)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Catalytic Fab 1D4, (mouse), kappa L chain [69141] (2 PDB entries)

8. Domain d1jgvl1: 1jgv L:1-107 [66694]
   Other proteins in same PDB: d1jgvh2, d1jgvl2

Details for d1jgvl1

PDB Entry: 1jgv, 1.85 Å

PDB Description: structural basis for disfavored elimination reaction in catalytic antibody 1d4

SCOP Domain Sequences for d1jgvl1:

Sequence; same for both SEQRES and ATOM records:

>d1jgvl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 1D4, (mouse), kappa L chain}
evvmtqsplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvppltfgagtklelk

Timeline for d1jgvl1:

• d1jgvl1 first appeared in SCOP 1.59
  
• d1jgvl1 appears in SCOP 1.63
  
• d1jgvl1 appears in the current release, SCOPe 2.08