SCOP 1.61: Domain d1jgvh2: 1jgv H:114-213

Lineage for d1jgvh2 (1jgv H:114-213)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Catalytic Fab 1D4, (mouse), kappa L chain [69152] (2 PDB entries)

8. Domain d1jgvh2: 1jgv H:114-213 [66693]
   Other proteins in same PDB: d1jgvh1, d1jgvl1

Details for d1jgvh2

PDB Entry: 1jgv, 1.85 Å

PDB Description: structural basis for disfavored elimination reaction in catalytic antibody 1d4

SCOP Domain Sequences for d1jgvh2:

Sequence; same for both SEQRES and ATOM records:

>d1jgvh2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 1D4, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1jgvh2:

• d1jgvh2 first appeared in SCOP 1.59
  
• d1jgvh2 appears in SCOP 1.63
  
• d1jgvh2 appears in the current release, SCOPe 2.07