Lineage for d1jgvh1 (1jgv H:1-113)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510779Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (14 PDB entries)
    Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity
  8. 1510781Domain d1jgvh1: 1jgv H:1-113 [66692]
    Other proteins in same PDB: d1jgvh2, d1jgvl1, d1jgvl2
    part of catalytic Fab 1D4

Details for d1jgvh1

PDB Entry: 1jgv (more details), 1.85 Å

PDB Description: structural basis for disfavored elimination reaction in catalytic antibody 1d4
PDB Compounds: (H:) antibody heavy chain

SCOPe Domain Sequences for d1jgvh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgvh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
evklvesrgglvkpggslqlscaasgftfsgyamswfrltpekrlewvasiyngfrihyl
dsvkgrftissdyarnilylqmstlrsedtamyycsrgdaysryfdvwgagttvtvsa

SCOPe Domain Coordinates for d1jgvh1:

Click to download the PDB-style file with coordinates for d1jgvh1.
(The format of our PDB-style files is described here.)

Timeline for d1jgvh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jgvh2