SCOP 1.59: Domain d1jguh1: 1jgu H:1-113

Lineage for d1jguh1 (1jgu H:1-113)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Catalytic Fab 1D4, (mouse), kappa L chain [69141] (2 PDB entries)

8. Domain d1jguh1: 1jgu H:1-113 [66688]
   Other proteins in same PDB: d1jguh2, d1jgul2

Details for d1jguh1

PDB Entry: 1jgu, 1.8 Å

PDB Description: structural basis for disfavored elimination reaction in catalytic antibody 1d4

SCOP Domain Sequences for d1jguh1:

Sequence; same for both SEQRES and ATOM records:

>d1jguh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 1D4, (mouse), kappa L chain}
evklvesrgglvkpggslqlscaasgftfsgyamswfrltpekrlewvasiyngfrihyl
dsvkgrftissdyarnilylqmstlrsedtamyycsrgdaysryfdvwgagttvtvsa

Timeline for d1jguh1:

• d1jguh1 is new in SCOP 1.59
  
• d1jguh1 appears in SCOP 1.61
  
• d1jguh1 appears in the current release, SCOPe 2.08