Lineage for d1jgta1 (1jgt A:210-508)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242042Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 242253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    the first three families are more closely related to each other as the last two families are
  5. 242254Family c.26.2.1: N-type ATP pyrophosphatases [52403] (5 proteins)
  6. 242280Protein beta-Lactam synthetase [69456] (1 species)
    Asparagine synthetase B homologue
  7. 242281Species Streptomyces clavuligerus [TaxId:1901] [69457] (5 PDB entries)
  8. 242282Domain d1jgta1: 1jgt A:210-508 [66684]
    Other proteins in same PDB: d1jgta2, d1jgtb2

Details for d1jgta1

PDB Entry: 1jgt (more details), 1.95 Å

PDB Description: crystal structure of beta-lactam synthetase

SCOP Domain Sequences for d1jgta1:

Sequence, based on SEQRES records: (download)

>d1jgta1 c.26.2.1 (A:210-508) beta-Lactam synthetase {Streptomyces clavuligerus}
pglsrrilpegeavaavraalekavaqrvtpgdtplvvlsggidssgvaacahraageld
tvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpyavwasesvdpdiieyllp
ltalyraldgperriltgygadiplggmhredrlpaldtvlahdmatfdglnemspvlst
laghwtthpywdrevldllvsleaglkrrhgrdkwvlraamadalpaetvnrpklgvheg
sgttssfsrllldhgvaedrvheakrqvvrelfdltvgggrhpsevdtddvvrsvadrt

Sequence, based on observed residues (ATOM records): (download)

>d1jgta1 c.26.2.1 (A:210-508) beta-Lactam synthetase {Streptomyces clavuligerus}
pglsrrilpegeavaavraalekavaqrvtpgdtplvvlsggidssgvaacahraageld
tvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpyavwasesvdpdiieyllp
ltalyraldgperriltgygadiplggmhredrlpaldtvlahdmatfdglnemspvlst
laghwtthpywdrevldllvsleaglkrrhgrdkwvlraamadalpaetvnrpklssfsr
llldhgvaedrvheakrqvvrelfdltvgggrhpsevdtddvvrsvadrt

SCOP Domain Coordinates for d1jgta1:

Click to download the PDB-style file with coordinates for d1jgta1.
(The format of our PDB-style files is described here.)

Timeline for d1jgta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jgta2