![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Amylosucrase [69384] (1 species) |
![]() | Species Neisseria polysaccharea [TaxId:489] [69385] (10 PDB entries) |
![]() | Domain d1jgia2: 1jgi A:1-554 [66677] Other proteins in same PDB: d1jgia1 complexed with suc; mutant |
PDB Entry: 1jgi (more details), 2 Å
SCOPe Domain Sequences for d1jgia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgia2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} spnsqylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpm lemllaqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkip yfqelgltylylmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisav vdfifnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsql edgrwvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavafiwkqmgtsce nlpqahalirafnavmriaapavffksqaivhpdqvvqyigqdecqigynplqmallwnt latrevnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnr ffvnrfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgg lpliylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqdlrh miavrqsnprfdgg
Timeline for d1jgia2: