SCOP 1.59: Domain d1jgcc_: 1jgc C:

Lineage for d1jgcc_ (1jgc C:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.25: Ferritin-like [47239] (1 superfamily)

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)

5. Family a.25.1.1: Ferritin [47241] (5 proteins)

6. Protein Bacterioferritin (cytochrome b1) [47244] (2 species)

7. Species Rhodobacter capsulatus [TaxId:1061] [69004] (1 PDB entry)

8. Domain d1jgcc_: 1jgc C: [66675]

Details for d1jgcc_

PDB Entry: 1jgc, 2.6 Å

PDB Description: The 2.6 A Structure Resolution of Rhodobacter capsulatus Bacterioferritin with Metal-free Dinuclear Site and Heme Iron in a Crystallographic Special Position

SCOP Domain Sequences for d1jgcc_:

Sequence; same for both SEQRES and ATOM records:

>d1jgcc_ a.25.1.1 (C:) Bacterioferritin (cytochrome b1) {Rhodobacter capsulatus}
mkgdakvieflnaalrseltaisqywvhfrlqedwglakmakksreesieemghadkiia
rilfleghpnlqkldplrigegpretlecdlagehdalklyreardycaevgdivsknif
eslitdeeghvdfletqislydrlgpqgfallnaapmdaa

Timeline for d1jgcc_:

• d1jgcc_ is new in SCOP 1.59
  
• d1jgcc_ appears in SCOP 1.61
  
• d1jgcc_ appears in the current release, SCOPe 2.08