Lineage for d1jgcb_ (1jgc B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96482Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 96483Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 96484Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 96533Protein Bacterioferritin (cytochrome b1) [47244] (2 species)
  7. 96561Species Rhodobacter capsulatus [TaxId:1061] [69004] (1 PDB entry)
  8. 96563Domain d1jgcb_: 1jgc B: [66674]

Details for d1jgcb_

PDB Entry: 1jgc (more details), 2.6 Å

PDB Description: The 2.6 A Structure Resolution of Rhodobacter capsulatus Bacterioferritin with Metal-free Dinuclear Site and Heme Iron in a Crystallographic Special Position

SCOP Domain Sequences for d1jgcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgcb_ a.25.1.1 (B:) Bacterioferritin (cytochrome b1) {Rhodobacter capsulatus}
mkgdakvieflnaalrseltaisqywvhfrlqedwglakmakksreesieemghadkiia
rilfleghpnlqkldplrigegpretlecdlagehdalklyreardycaevgdivsknif
eslitdeeghvdfletqislydrlgpqgfallnaapmdaa

SCOP Domain Coordinates for d1jgcb_:

Click to download the PDB-style file with coordinates for d1jgcb_.
(The format of our PDB-style files is described here.)

Timeline for d1jgcb_: