Lineage for d1jg9a2 (1jg9 A:1-554)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116349Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (13 proteins)
  6. 116354Protein Amylosucrase [69384] (1 species)
  7. 116355Species Neisseria polysaccharea [TaxId:489] [69385] (3 PDB entries)
  8. 116357Domain d1jg9a2: 1jg9 A:1-554 [66672]
    Other proteins in same PDB: d1jg9a1

Details for d1jg9a2

PDB Entry: 1jg9 (more details), 1.66 Å

PDB Description: Crystal Structure of Amylosucrase from Neisseria polysaccharea in Complex with D-glucose

SCOP Domain Sequences for d1jg9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jg9a2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea}
spnsqylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpm
lemllaqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkip
yfqelgltylhlmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisav
vdfifnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsql
edgrwvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavafiwkqmgtsce
nlpqahalirafnavmriaapavffkseaivhpdqvvqyigqdecqigynplqmallwnt
latrevnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnr
ffvnrfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgg
lpliylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqdlrh
miavrqsnprfdgg

SCOP Domain Coordinates for d1jg9a2:

Click to download the PDB-style file with coordinates for d1jg9a2.
(The format of our PDB-style files is described here.)

Timeline for d1jg9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jg9a1