![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Amylosucrase [69328] (1 species) |
![]() | Species Neisseria polysaccharea [TaxId:489] [69329] (10 PDB entries) |
![]() | Domain d1jg9a1: 1jg9 A:555-628 [66671] Other proteins in same PDB: d1jg9a2 complexed with glc |
PDB Entry: 1jg9 (more details), 1.66 Å
SCOPe Domain Sequences for d1jg9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jg9a1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd ltlqpyqvmwleia
Timeline for d1jg9a1: