Lineage for d1jg5e_ (1jg5 E:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 422643Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165
  4. 422644Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family) (S)
  5. 422645Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (1 protein)
  6. 422646Protein GTP cyclohydrolase I feedback regulatory protein, GFRP [69763] (1 species)
  7. 422647Species Rat (Rattus norvegicus) [TaxId:10116] [69764] (3 PDB entries)
  8. 422652Domain d1jg5e_: 1jg5 E: [66670]
    complexed with k

Details for d1jg5e_

PDB Entry: 1jg5 (more details), 2.6 Å

PDB Description: crystal structure of rat gtp cyclohydrolase i feedback regulatory protein, gfrp

SCOP Domain Sequences for d1jg5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jg5e_ d.205.1.1 (E:) GTP cyclohydrolase I feedback regulatory protein, GFRP {Rat (Rattus norvegicus)}
pyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkle
crgfrvlsmtgvgqtlvwclhke

SCOP Domain Coordinates for d1jg5e_:

Click to download the PDB-style file with coordinates for d1jg5e_.
(The format of our PDB-style files is described here.)

Timeline for d1jg5e_: