Lineage for d1jg3a_ (1jg3 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839581Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 839582Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) (S)
  5. 839693Family c.66.1.7: Protein-L-isoaspartyl O-methyltransferase [53354] (1 protein)
    topological variant; strand order 3214567; strand 6 is antiparallel to the rest
  6. 839694Protein Protein-L-isoaspartyl O-methyltransferase [68927] (5 species)
  7. 839695Species Archaeon Pyrococcus furiosus [TaxId:2261] [69553] (4 PDB entries)
  8. 839699Domain d1jg3a_: 1jg3 A: [66663]

Details for d1jg3a_

PDB Entry: 1jg3 (more details), 2.1 Å

PDB Description: Crystal Structure of L-isoaspartyl (D-aspartyl) O-methyltransferase with adenosine & VYP(ISP)HA substrate
PDB Compounds: (A:) protein-l-isoaspartate o-methyltransferase

SCOP Domain Sequences for d1jg3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jg3a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]}
ekelyekwmrtvemlkaegiirskeveraflkyprylsvedkykkyahideplpipagqt
vsaphmvaimleianlkpgmnilevgtgsgwnaaliseivktdvytieripelvefakrn
leragvknvhvilgdgskgfppkapydviivtagapkipeplieqlkiggkliipvgsyh
lwqellevrktkdgikiknhggvafvpligeygwk

SCOP Domain Coordinates for d1jg3a_:

Click to download the PDB-style file with coordinates for d1jg3a_.
(The format of our PDB-style files is described here.)

Timeline for d1jg3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jg3b_