Lineage for d1jfzd_ (1jfz D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017406Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2017407Superfamily a.149.1: RNase III domain-like [69065] (3 families) (S)
  5. 2017408Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
    Pfam PF00636
  6. 2017412Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 2017413Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)
  8. 2017424Domain d1jfzd_: 1jfz D: [66658]
    Other proteins in same PDB: d1jfzb2, d1jfzc2
    protein/RNA complex; complexed with mn

Details for d1jfzd_

PDB Entry: 1jfz (more details), 2.1 Å

PDB Description: Crystal Structure of MN(II)-Complex of RNAse III Endonuclease Domain from Aquifex Aeolicus at 2.10 Angstrom Resolution
PDB Compounds: (D:) Ribonuclease III

SCOPe Domain Sequences for d1jfzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfzd_ a.149.1.1 (D:) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
sgrdanftrelfyklfkedilsaikegr

SCOPe Domain Coordinates for d1jfzd_:

Click to download the PDB-style file with coordinates for d1jfzd_.
(The format of our PDB-style files is described here.)

Timeline for d1jfzd_: