![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.149: RNase III domain-like [69064] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.149.1: RNase III domain-like [69065] (3 families) ![]() |
![]() | Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins) Pfam PF00636 |
![]() | Protein RNase III endonuclease catalytic domain [69067] (2 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries) |
![]() | Domain d1jfzb1: 1jfz B:200-347 [66656] Other proteins in same PDB: d1jfzb2, d1jfzc2 protein/RNA complex; complexed with mn |
PDB Entry: 1jfz (more details), 2.1 Å
SCOPe Domain Sequences for d1jfzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfzb1 a.149.1.1 (B:200-347) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]} gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid sgrdanftrelfyklfkedilsaikegr
Timeline for d1jfzb1:
![]() Domains from other chains: (mouse over for more information) d1jfza_, d1jfzc1, d1jfzc2, d1jfzd_ |