Lineage for d1jfzb_ (1jfz B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650106Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 650107Superfamily a.149.1: RNase III domain-like [69065] (2 families) (S)
  5. 650108Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
    Pfam PF00636
  6. 650112Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 650113Species Aquifex aeolicus [TaxId:63363] [69068] (9 PDB entries)
  8. 650120Domain d1jfzb_: 1jfz B: [66656]

Details for d1jfzb_

PDB Entry: 1jfz (more details), 2.1 Å

PDB Description: Crystal Structure of MN(II)-Complex of RNAse III Endonuclease Domain from Aquifex Aeolicus at 2.10 Angstrom Resolution
PDB Compounds: (B:) Ribonuclease III

SCOP Domain Sequences for d1jfzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfzb_ a.149.1.1 (B:) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
sgrdanftrelfyklfkedilsaikegrh

SCOP Domain Coordinates for d1jfzb_:

Click to download the PDB-style file with coordinates for d1jfzb_.
(The format of our PDB-style files is described here.)

Timeline for d1jfzb_: