SCOP 1.65: Domain d1jfzb_: 1jfz B:

Lineage for d1jfzb_ (1jfz B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.149: RNase III endonuclease catalytic domain [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III endonuclease catalytic domain [69065] (1 family)

5. Family a.149.1.1: RNase III endonuclease catalytic domain [69066] (1 protein)

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [69068] (2 PDB entries)

8. Domain d1jfzb_: 1jfz B: [66656]

Details for d1jfzb_

PDB Entry: 1jfz, 2.1 Å

PDB Description: Crystal Structure of MN(II)-Complex of RNAse III Endonuclease Domain from Aquifex Aeolicus at 2.10 Angstrom Resolution

SCOP Domain Sequences for d1jfzb_:

Sequence; same for both SEQRES and ATOM records:

>d1jfzb_ a.149.1.1 (B:) RNase III endonuclease catalytic domain {Aquifex aeolicus}
gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
sgrdanftrelfyklfkedilsaikegrh

Timeline for d1jfzb_:

• d1jfzb_ first appeared in SCOP 1.59
  
• d1jfzb_ appears in SCOP 1.63
  
• d1jfzb_ appears in SCOP 1.67
  
• d1jfzb_ appears in the current release, SCOPe 2.08, called d1jfzb1