Lineage for d1jfzb_ (1jfz B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218559Fold a.149: RNase III endonuclease catalytic domain [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 218560Superfamily a.149.1: RNase III endonuclease catalytic domain [69065] (1 family) (S)
  5. 218561Family a.149.1.1: RNase III endonuclease catalytic domain [69066] (1 protein)
  6. 218562Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 218563Species Aquifex aeolicus [TaxId:63363] [69068] (2 PDB entries)
  8. 218565Domain d1jfzb_: 1jfz B: [66656]

Details for d1jfzb_

PDB Entry: 1jfz (more details), 2.1 Å

PDB Description: Crystal Structure of MN(II)-Complex of RNAse III Endonuclease Domain from Aquifex Aeolicus at 2.10 Angstrom Resolution

SCOP Domain Sequences for d1jfzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfzb_ a.149.1.1 (B:) RNase III endonuclease catalytic domain {Aquifex aeolicus}
gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
sgrdanftrelfyklfkedilsaikegrh

SCOP Domain Coordinates for d1jfzb_:

Click to download the PDB-style file with coordinates for d1jfzb_.
(The format of our PDB-style files is described here.)

Timeline for d1jfzb_: