Lineage for d1jfza_ (1jfz A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101882Fold a.149: RNase III endonuclease domain [69064] (1 superfamily)
  4. 101883Superfamily a.149.1: RNase III endonuclease domain [69065] (1 family) (S)
  5. 101884Family a.149.1.1: RNase III endonuclease domain [69066] (1 protein)
  6. 101885Protein RNase III endonuclease domain [69067] (1 species)
  7. 101886Species Aquifex aeolicus [TaxId:63363] [69068] (2 PDB entries)
  8. 101887Domain d1jfza_: 1jfz A: [66655]

Details for d1jfza_

PDB Entry: 1jfz (more details), 2.1 Å

PDB Description: Crystal Structure of MN(II)-Complex of RNAse III Endonuclease Domain from Aquifex Aeolicus at 2.10 Angstrom Resolution

SCOP Domain Sequences for d1jfza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfza_ a.149.1.1 (A:) RNase III endonuclease domain {Aquifex aeolicus}
gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
sgrdanftrelfyklfkedilsaikegr

SCOP Domain Coordinates for d1jfza_:

Click to download the PDB-style file with coordinates for d1jfza_.
(The format of our PDB-style files is described here.)

Timeline for d1jfza_: