Lineage for d1jfta2 (1jft A:59-341)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913112Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)
  7. 2913113Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)
  8. 2913123Domain d1jfta2: 1jft A:59-341 [66653]
    Other proteins in same PDB: d1jfta1
    protein/DNA complex; complexed with hpa, po4; mutant

Details for d1jfta2

PDB Entry: 1jft (more details), 2.5 Å

PDB Description: purine repressor mutant-hypoxanthine-purf operator complex
PDB Compounds: (A:) purine nucleotide synthesis repressor

SCOPe Domain Sequences for d1jfta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfta2 c.93.1.1 (A:59-341) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdageakadftdavidnafeggymagryliergh
reigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyrr

SCOPe Domain Coordinates for d1jfta2:

Click to download the PDB-style file with coordinates for d1jfta2.
(The format of our PDB-style files is described here.)

Timeline for d1jfta2: