SCOP 1.63: Domain d1jfql2: 1jfq L:109-215

Lineage for d1jfql2 (1jfq L:109-215)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab 36-71 (mouse), kappa L chain [49000] (2 PDB entries)

8. Domain d1jfql2: 1jfq L:109-215 [66649]
   Other proteins in same PDB: d1jfqh1, d1jfql1

Details for d1jfql2

PDB Entry: 1jfq, 1.9 Å

PDB Description: antigen-binding fragment of the murine anti-phenylarsonate antibody 36-71, "fab 36-71"

SCOP Domain Sequences for d1jfql2:

Sequence; same for both SEQRES and ATOM records:

>d1jfql2 b.1.1.2 (L:109-215) Immunoglobulin (constant domains of L and H chains) {Fab 36-71 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrneca

Timeline for d1jfql2:

• d1jfql2 first appeared in SCOP 1.59
  
• d1jfql2 appears in SCOP 1.61
  
• d1jfql2 appears in SCOP 1.65
  
• d1jfql2 appears in the current release, SCOPe 2.08