Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab 36-71 (mouse), kappa L chain [48779] (2 PDB entries) |
Domain d1jfqh1: 1jfq H:302-421 [66646] Other proteins in same PDB: d1jfqh2, d1jfql2 |
PDB Entry: 1jfq (more details), 1.9 Å
SCOP Domain Sequences for d1jfqh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfqh1 b.1.1.1 (H:302-421) Immunoglobulin (variable domains of L and H chains) {Fab 36-71 (mouse), kappa L chain} vqlqqsgvelvragssvkmsckasgytftsnginwvkqrpgqglewigynnpgngyityn ekfkgkttltvdkssntaymqlrsltsedsavyfcarseyyggsykfdywgqgttltvss
Timeline for d1jfqh1: