| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein NK cell ligand RAE-1 beta [69683] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [69684] (2 PDB entries) |
| Domain d1jfme_: 1jfm E: [66644] |
PDB Entry: 1jfm (more details), 2.85 Å
SCOPe Domain Sequences for d1jfme_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfme_ d.19.1.1 (E:) NK cell ligand RAE-1 beta {Mouse (Mus musculus) [TaxId: 10090]}
dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
Timeline for d1jfme_:
View in 3DDomains from other chains: (mouse over for more information) d1jfma_, d1jfmb_, d1jfmc_, d1jfmd_ |